Engenharia genética/Desenho dos primers

Origem: Wikilivros, livros abertos por um mundo aberto.
Saltar para a navegação Saltar para a pesquisa

Objetivo[editar | editar código-fonte]

  • Desenhar os primers necessários para amplificar o gene GFP do vetor pUG35.

Conhecer o Vetor pUG35[editar | editar código-fonte]

Encontrar a sequência nucleotídica do vetor pUG35[editar | editar código-fonte]

  • O ficheiro então apresentado assenta na seguinte estrutura:

LOCUS: AF298787 6231 bp DNA circular SYN 26-NOV-2000 (Nome curto para esta sequência).

DEFINITION: C-terminal GFP fusion vector pUG35, complete sequence (Definição da sequência).

ACCESSION: AF298787 (Número de acesso de entrada).

VERSION: AF298787.1 GI:11344888 (Versão de entrada).

KEYWORDS: (Palavras-chave da entrada).

SOURCE: C-terminal GFP fusion vector pUG35.

ORGANISM: C-terminal GFP fusion vector pUG35 (O organismo a partir do qual a sequência derivou).

REFERENCE: 1 (bases 1 a 6231)

AUTHORS: Gueldener,U. and Hegemann,J.H. (Autores do trabalho).

TITLE: A second generation of GFP-vectors for subcelluar localization studies in budding yeast (Título da publicação).

JOURNAL: Unpublished (Jornal de referência para a entrada).

...

FEATURES: Location/Qualifiers (Características da sequência).

source 1..6231
organism C-terminal GFP fusion vector pUG35
mol_type other DNA
db_xref taxon:142955
note derived from Saccharomyces cerevisiae
gene 417..1220
gene URA3
CDS: 417..1220 (Sequência codificante, a parte do gene que codifica para uma proteína)
gene URA3
codon_start 1
transl_table 11
product orotidine-5'-phosphate decarboxylase
protein_id AAG34528.1
db_xref GI:11344889
translation MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVK

LQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDM GGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN

terminator 2004..2262
note from CYC1
gene complement(2271..2987)
gene EGFP3
CDS: complement(2271..2987)
gene EGFP3
codon_start 1
transl_table 11
product enhanced green fluorescent protein 3
protein_id AAG34529.1
db_xref GI:11344890
translation MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDF

FKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRH NIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

promoter 3051..3443
note from MET25
rep_origin 3882..3954 (Início da sequência)
  • De seguida, encontra-se a sequência completa do vector pUG35.

Encontrar a sequência nucleotídica da CDS do gene GFP[editar | editar código-fonte]

  • Para analisar apenas a sequência que codifica o gene GFP, clique em “CDS” para “EGFP3”.
  • Ao fundo, encontra a seguinte sequência:
1 ttatttgtac aattcatcca taccatgggt aataccagca gcagtaacaa attctaacaa
61 gaccatgtgg tctctctttt cgtttggatc tttggataag gcagattgag tggataagta
121 atggttgtct ggtaacaaga ctggaccatc accaattgga gtattttgtt gataatggtc
181 agctaattga acagaaccat cttcaatgtt gtgtctaatt ttgaagttaa ctttgatacc
241 attcttttgt ttgtcagcca tgatgtaaac attgtgagag ttatagttgt attccaattt
301 gtgacctaaa atgttaccat cttctttaaa atcaatacct tttaattcga ttctattaac
361 taaggtatca ccttcaaact tgacttcagc tctggtcttg tagttaccgt catctttgaa
421 aaaaatagtt ctttcttgaa cataaccttc tggcatggca gacttgaaaa agtcatgttg
481 tttcatatga tctgggtatc tagcaaaaca ttgaacacca taaccgaaag tagtgactaa
541 ggttggccat ggaactggca atttaccagt agtacaaata aattttaagg tcaatttacc
601 gtaagtagca tcaccttcac cttcaccgga gacagaaaat ttgtgaccat taacatcacc
661 atctaattca accaaaattg ggacaacacc agtgaataat tcttcacctt tagacat
  • As duas cadeias do DNA, denominam-se Watson e Crick:
Watson    5’-ATG…TAA-3’
Crick     3’-TAC…ATT-5’

O DNA é sempre exibido na forma 5'-3' por isso, normalmente, a cadeia Crick é invisível.

No entanto, na sequência obtida para o gene GFP, só vemos a cadeia Crick.

  • Nota: A sequência codificante (CDS) deve começar com “atg” (codão start) e acabar com ”taa” (codão stop).

Como pode observar, a sequência apresentada é a da cadeia complementar, de modo que o codão start está na base (cat ⇒ atg) e o codão stop está no topo (tta ⇒ taa).

Construir os primers para amplificar o gene GFP[editar | editar código-fonte]

  • Vamos amplificar o gene GFP inteiro, incluindo os codões start e stop (mas nada fora do gene).
  • Precisamos de dois primers para o PCR, um primer forward e um primer reverse.

O primer forward liga-se à cadeia Crick e o primer reverse liga-se à cadeia Watson.

  • De seguida, apresenta-se a cadeia reverse complement correspondente à sequência Crick obtida anteriormente para o gene EFGP3:
5'- ATGTCTA AAGGTGAAGA ATTATTCACT GGTGTTGTCC CAATTTTGGT TGAATTAGAT GGTGATGTTA ATGGTCACAA ATTTTCTGTC TCCGGTGAAG
GTGAAGGTGA TGCTACTTAC GGTAAATTGA CCTTAAAATT TATTTGTACT ACTGGTAAAT TGCCAGTTCC ATGGCCAACC TTAGTCACTA CTTTCGGTTA 
TGGTGTTCAA TGTTTTGCTA GATACCCAGA TCATATGAAA CAACATGACT TTTTCAAGTC TGCCATGCCA GAAGGTTATG TTCAAGAAAG AACTATTTTT 
TTCAAAGATG ACGGTAACTA CAAGACCAGA GCTGAAGTCA AGTTTGAAGG TGATACCTTA GTTAATAGAA TCGAATTAAA AGGTATTGAT TTTAAAGAAG 
ATGGTAACAT TTTAGGTCAC AAATTGGAAT ACAACTATAA CTCTCACAAT GTTTACATCA TGGCTGACAA ACAAAAGAAT GGTATCAAAG TTAACTTCAA 
AATTAGACAC AACATTGAAG ATGGTTCTGT TCAATTAGCT GACCATTATC AACAAAATAC TCCAATTGGT GATGGTCCAG TCTTGTTACC AGACAACCAT 
TACTTATCCA CTCAATCTGC CTTATCCAAA GATCCAAACG AAAAGAGAGA CCACATGGTC TTGTTAGAAT TTGTTACTGC TGCTGGTATT ACCCATGGTA 
TGGATGAATT GTACAAATAA -3'
  • Temos, então, toda a informação necessária para desenhar os primers:

Primer Forward: 5' - ATG TCT AAA GGT GAA GAA TTA TTC A - 3'

Primer Reverse: 5' - TTA TTT GTA CAA TTC ATC CAT ACC A - 3'

Explicação:

cadeia molde - 5' - ATG TCT AAA GGT GAA GAA TTA TTC ACT ... CAT GGT ATG GAT GAA TTG TAC AAA TAA - 3'

Primer Reverse ------------------------------------------------------------------ 3' - A CCA TAC CTA CTT AAC ATG TTT ATT - 5'

Primer Forward ---------------- 5' - ATG TCT AAA GGT GAA GAA TTA TTC A - 3'

cadeia molde complementar - 3' - TAC AGA TTT CCA CTT CTT AAT AAG TGA ... GTA CCA TAC CTA CTT AAC ATG TTT ATT - 5'

Propriedades dos primers construídos para amplificar o gene GFP[editar | editar código-fonte]

  • Pretende-se que os primers tenham uma Tm (melting temperature) de 49-51 °C.

Utilizando o programa Oligonucleotide properties calulator pode calcular a Tm automaticamente.

Também pode calculá-la manualmente, aplicando as seguintes fórmulas aritméticas:
* Para sequências inferiores a 14 nucleótidos:
     Tm= (wA+xT) * 2 + (yG+zC) * 4
     onde w,x,y,z são o número de bases A,T,G,C na sequência, respectivamente.
* Para sequências superiores a 13 nucleótidos:
     Tm= 64.9 +41*(yG+zC-16.4)/(wA+xT+yG+zC)
Nota:
Ambas as equações assumem que o Emparelhamento ocorre nas condições padrão de 50 nM primer, 50 mM Na+ e pH 7.0.

Propriedades correspondentes aos primers Forward e Reverse, quanto à temperatura média de desnaturação (Tm), ao tamanho da sequência (quantidade de nucleótidos) e à percentagem de guaninas e citosinas (% GC).[editar | editar código-fonte]

Primer Forward Reverse
Tm (Basic) 49 °C 49 °C
Tamanho 25 nucleótidos 25 nucleótidos
Conteúdo GC 28% 28%